DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG13430

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:254 Identity:87/254 - (34%)
Similarity:136/254 - (53%) Gaps:13/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC--KI 117
            |.|:.|.|:.:.:.  ..|||.|.:...:..|:|.:|.......||..|::...||||.||  :.
  Fly    15 ICTSAAQNSTDVEQ--DGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEY 77

  Fly   118 GNPGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYT-MKNDLCMMKLKTPLNVGRCVQKVKLPS 181
            ..|..|.:||||:...:||....|:|.:.||.:.:.| |.||:.:::|:.||...:.::.:.|.:
  Fly    78 SKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLAT 142

  Fly   182 TRTKRFPKCYL-ASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KR 243
            ::....|...| .||||.||.:....::.||..:|....:.:|.::|.|.| .:...|.||  :.
  Fly   143 SKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAG-TVTNTMFCAGTQA 206

  Fly   244 KNRDTCSGDSGGPLVH--NG--VLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVAKK 298
            ..||:|.||||||||.  :|  .||||.|:|.|||:|.:||:|..|..|..||.:..::
  Fly   207 GGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 81/228 (36%)
Tryp_SPc 74..295 CDD:238113 82/230 (36%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 81/228 (36%)
Tryp_SPc 32..262 CDD:238113 82/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443352
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.