DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG32269

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:305 Identity:96/305 - (31%)
Similarity:140/305 - (45%) Gaps:25/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GIVVIANLWIL---VVGGQSKNWSGYYVDNGTHYLLYEGPRIKPQTFLPGNISTNPAINALEAQ- 67
            |::::|.|..|   |...|.:.......||||..|    ...|.||.:..|.....| ..|.|: 
  Fly    33 GMLLLAELTQLGEAVTANQQRRNRRLRSDNGTKRL----TGTKNQTGIRSNRRQGTA-RKLSAKR 92

  Fly    68 ----------DYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIG-NPG 121
                      ..:.:|||.|.....|..||...|...:. :|...::..:|:|||.||..| :..
  Fly    93 VNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRRGSN-LCSGSLITEQWVLTAAHCVKGYSAS 156

  Fly   122 RYTVRAGSTQ-QRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTK 185
            .:|||.|:|. ....|..|.|......|.::...|..|..::||...| .|..:..:.:.:.|.|
  Fly   157 DFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSL-TGTNIGTISMGNYRPK 220

  Fly   186 RFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCS 250
            ...:..:| |||:|...:....:.|:...:..|.:.||::||||.. .|.|.|:||:...:|:||
  Fly   221 AGSRVRIA-GWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQA-TITKYMLCARAAGKDSCS 283

  Fly   251 GDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKV 295
            ||||||:..|..|.||.|||.|||.|.|||||..|:...:|...:
  Fly   284 GDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 77/220 (35%)
Tryp_SPc 74..295 CDD:238113 77/222 (35%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 77/219 (35%)
Tryp_SPc 121..324 CDD:238113 72/206 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.