DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG32270

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:232 Identity:77/232 - (33%)
Similarity:116/232 - (50%) Gaps:8/232 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC-KIGNPGRYTVRAGSTQQRRGG 136
            |||.|........|:...:.....|.||..::..|.:|||.|| ..|||..:.||.|.|......
  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMR 94

  Fly   137 QLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGLTSA 201
            ..|:|:|.:....||..|:.:|:.:::||.||...  :.|....:.|:.|.......||||||.:
  Fly    95 NSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQAS--IAKPISLAVRSPRPGSFVRVSGWGLTDS 157

  Fly   202 NAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKN-RDTCSGDSGGPLVH-NGVLY 264
            ::.::...|:.|.|..:.:.:|:..|||.. .|...|.||.... :|.|:||||||:|: ||:|.
  Fly   158 SSTSLPNQLQSVHVQVMPQRECRDLYRGYR-NITSSMFCASVPGLKDACAGDSGGPVVNSNGILV 221

  Fly   265 GITSFGIG--CASAKYPGVYVNVLQYTRWIKKVAKKY 299
            |:.|:|..  ||:...||||.:|...:.||.....:|
  Fly   222 GVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIHRY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 74/223 (33%)
Tryp_SPc 74..295 CDD:238113 75/225 (33%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 74/223 (33%)
Tryp_SPc 31..254 CDD:238113 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.