DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG32833

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:269 Identity:67/269 - (24%)
Similarity:110/269 - (40%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCK 116
            |.||:|.|.|.::..:          :|.||..|.|:.: |                |:||..|.
  Fly    43 PVNITTAPWIASISIK----------QKAKCDGAIYKLS-H----------------IVTAGKCV 80

  Fly   117 IGNPGR-YTVRAGSTQQRRGGQLRHVQKTVC----HPNYSEYTMKNDLCMMKLKTPLNVGRCVQK 176
            .|...: ..||.|||.:..|    .::..||    |..::..|:.:::.::||..||...:.:|.
  Fly    81 DGFLNKVIRVRVGSTTRSDG----VIEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQP 141

  Fly   177 V----KLPSTRTKRFPKCYLASGWGL--------------TSANAQNVQRYLRGVIVCKVSRAKC 223
            :    :|||...|     ..|:||..              .:...|..:..|.|...|....|:.
  Fly   142 IQLANQLPSNGAK-----VTANGWPSFRWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARN 201

  Fly   224 QQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQY 288
            ....:    .....:.|.::..::.||...|.|:||||.|.||.:.| ||  ::||.||:|:::|
  Fly   202 NWSKK----NFTDDLFCTEKFAKEACSLAMGSPVVHNGKLVGIITKG-GC--SEYPEVYINLIKY 259

  Fly   289 TRWIKKVAK 297
            ..|:....|
  Fly   260 KDWLHNHTK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 59/241 (24%)
Tryp_SPc 74..295 CDD:238113 60/243 (25%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 66/265 (25%)
Tryp_SPc 40..262 CDD:214473 65/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.