DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG11192

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:245 Identity:87/245 - (35%)
Similarity:120/245 - (48%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PT----RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNP---GRYTVRAG 128
            ||    |||.|:.......|||.::......|||..|:....:|||.|| ..:|   ..||||.|
  Fly    21 PTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHC-FEDPWSSADYTVRVG 84

  Fly   129 STQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKL-----PSTRTKRFP 188
            |::...||.:..:::.:.|.:|:..:..|||.::.|...||....:|.|.|     |.|...|..
  Fly    85 SSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQ 149

  Fly   189 KCYLASGWGLTSANAQ-----NVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDT 248
                .||||..:..:.     .|...||.|.|..|...:|::.|... :.|.::||||.|..||:
  Fly   150 ----VSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQV-LPITRRMICAARPGRDS 209

  Fly   249 CSGDSGGPLVHNGV------LYGITSFGIGCASAKYPGVYVNVLQYTRWI 292
            |.||||||||....      ||||.|:|:|||:..:||||.||..:..||
  Fly   210 CQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 83/237 (35%)
Tryp_SPc 74..295 CDD:238113 84/238 (35%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 83/237 (35%)
Tryp_SPc 28..262 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.