DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and iotaTry

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:251 Identity:78/251 - (31%)
Similarity:109/251 - (43%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EAQDYLPT-RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC---------KIGN 119
            :|.|...| ||:.|.......||:|.::..:....||.||.::..|:||.||         |   
  Fly    18 DASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMK--- 79

  Fly   120 PGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRT 184
                 ||.|:.....||.|..|.....|..:....:..|:.:::|.|||..|...:.:.|.||. 
  Fly    80 -----VRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTS- 138

  Fly   185 KRFPK---CYLASGWGLT-----SANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIK-IYKQMIC 240
               |.   ....:|||.|     |.:.|..|..:       :.|.:|.....|.|.. :.::.||
  Fly   139 ---PSGGTTVTVTGWGHTDNGALSDSLQKAQLQI-------IDRGECASQKFGYGADFVGEETIC 193

  Fly   241 AKRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVA 296
            |...:.|.|:||||||||.:..|.||.|:|..||...|||||.:|.....||.|.|
  Fly   194 AASTDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKAA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 71/236 (30%)
Tryp_SPc 74..295 CDD:238113 72/238 (30%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 71/236 (30%)
Tryp_SPc 28..247 CDD:238113 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
54.840

Return to query results.
Submit another query.