DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and thetaTry

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:232 Identity:77/232 - (33%)
Similarity:111/232 - (47%) Gaps:22/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALH--YNNYFICGCVILNRRWILTAQHCKIGNP-GRYTVRAGSTQQRR 134
            |||.|:.......|||.:|.  ..::| ||..::|...::||.||.:|.. .:..||.|||....
  Fly    34 RIVGGEDTTIGAHPYQVSLQTKSGSHF-CGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNE 97

  Fly   135 GGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKL----PSTRTKRF-----PKC 190
            ||.:..|::...:.:|:..||:.|:.::||...:.....::.::|    |.|.|...     .||
  Fly    98 GGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKC 162

  Fly   191 YLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGG 255
            |.   |.:|      :.:.|:.|.|..|....|..|....|..||..|:||..|.:|.|.|||||
  Fly   163 YF---WCMT------LPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEKKKDACQGDSGG 218

  Fly   256 PLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292
            ||.....|.||.|:|..|||...||||.:|....:||
  Fly   219 PLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 75/230 (33%)
Tryp_SPc 74..295 CDD:238113 76/231 (33%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 75/230 (33%)
Tryp_SPc 35..255 CDD:238113 74/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
54.840

Return to query results.
Submit another query.