DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:241 Identity:85/241 - (35%)
Similarity:121/241 - (50%) Gaps:20/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC--KIGNPGRYTVRAGST--QQR 133
            |||.|.:......|:|.:|..|....||..|:|.||:::|.||  :..:|.::....|:|  ...
Human   236 RIVGGMEASPGEFPWQASLRENKEHFCGAAIINARWLVSAAHCFNEFQDPTKWVAYVGATYLSGS 300

  Fly   134 RGGQLR-HVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFP---KCYLAS 194
            ....:| .|.:.|.||.|:..|...|:.:::|.:||..||.:|.|.||:. |..||   || |.|
Human   301 EASTVRAQVVQIVKHPLYNADTADFDVAVLELTSPLPFGRHIQPVCLPAA-THIFPPSKKC-LIS 363

  Fly   195 GWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNR--DTCSGDSGGPL 257
            |||....:.......|:...|..:.:|.|...|   |..:..:|:||...:.  |:|.|||||||
Human   364 GWGYLKEDFLVKPEVLQKATVELLDQALCASLY---GHSLTDRMVCAGYLDGKVDSCQGDSGGPL 425

  Fly   258 V---HNG--VLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVAKK 298
            |   .:|  .|.||.|:|||||.|:.||||..|.:...||.:...|
Human   426 VCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEATTK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 82/233 (35%)
Tryp_SPc 74..295 CDD:238113 83/235 (35%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.