DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG17571

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:239 Identity:76/239 - (31%)
Similarity:116/239 - (48%) Gaps:12/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALH--YNNYFICGCVILNRRWILTAQHC-KIGN 119
            ||.:      |:...|||||:.:.....|||.::.  ..::| ||..:::...:|||.|| :...
  Fly    21 NPGL------DFPFGRIVNGEDVDIENYPYQVSVQTTKGSHF-CGGSLIDSETVLTAAHCMQSYA 78

  Fly   120 PGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRT 184
            .....||.|||.:..||::..|:....|..|:...|.||:.::||.:|:.....::.::|..:..
  Fly    79 ASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEA 143

  Fly   185 KRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQD-YRGTGIKIYKQMICAKRKNRDT 248
            ...... :.||||.|.....:....|:.|.|..:....|..| |......|.:.|:||..:.:|.
  Fly   144 VSGTNA-VVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDA 207

  Fly   249 CSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292
            |.||||||||.:..|.|:.|:|.|||...|||||.:|.....||
  Fly   208 CQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 71/222 (32%)
Tryp_SPc 74..295 CDD:238113 72/223 (32%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 71/222 (32%)
Tryp_SPc 31..254 CDD:238113 72/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
54.840

Return to query results.
Submit another query.