DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Phae2

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:251 Identity:78/251 - (31%)
Similarity:108/251 - (43%) Gaps:27/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRY---TVRA 127
            |.|....|:|.||....:.|||..::.|.....|...|:|..|::||.|| :.|..:.   |:.|
  Fly    24 ALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHC-LANRNQVLGSTLVA 87

  Fly   128 G--------STQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRT 184
            |        ||.|:|  |:.|.   |.:..|:..|:..|:.::...|.......|..|||||:..
  Fly    88 GSIAVAGTASTTQKR--QITHY---VINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGV 147

  Fly   185 KRFPKCYLASGWGLTSANAQNVQRYLRGVIVCK----VSRAKCQQDYRGTGIKIYKQMICAKRKN 245
            :...|..| .|||.||..  |...|.:.:...|    :|...|.......|..::...:|.....
  Fly   148 RPTGKADL-FGWGSTSKT--NSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLT 209

  Fly   246 RDT--CSGDSGGPLVHNGVLYGITSFG-IGCASAKYPGVYVNVLQYTRWIKKVAKK 298
            ..|  |:.|||||||...||.||.|:| :.|.....|.|||.|..:..||....||
  Fly   210 GGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAANQKK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 72/236 (31%)
Tryp_SPc 74..295 CDD:238113 73/238 (31%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 72/236 (31%)
Tryp_SPc 32..262 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.