DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and PRSS53

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:293 Identity:64/293 - (21%)
Similarity:98/293 - (33%) Gaps:110/293 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PYQCALHYNNYFICGCVILNRRWILTAQHC--------------KIG-------NPGRYTVRAGS 129
            |:|.::......||...::...|:|||.||              .:|       :||...|...:
Human    49 PWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAA 113

  Fly   130 TQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKL-----KTPLNVGRCVQKVKLPSTRTKRFP- 188
            .|..|.              |:.|:..:||.:::|     .|||    |     ||.. ..||| 
Human   114 LQLPRA--------------YNHYSQGSDLALLQLAHPTTHTPL----C-----LPQP-AHRFPF 154

  Fly   189 --KCYLASGWGLTSANAQNVQRYLRGVIVC----KVSRAKC------------------------ 223
              .|: |:||...:::.:...|...|..:|    .||...|                        
Human   155 GASCW-ATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAP 218

  Fly   224 --------QQDYRGTGIKIYKQ-------------MICAKRKN--RDTCSGDSGGPLV-----HN 260
                    :...|.|...||.|             |:|...:.  :..|.||||||::     .:
Human   219 GTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGH 283

  Fly   261 GVLYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293
            .|..||.||...||....|.:..|...::.|::
Human   284 WVQAGIISFASSCAQEDAPVLLTNTAAHSSWLQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 63/290 (22%)
Tryp_SPc 74..295 CDD:238113 64/293 (22%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 64/291 (22%)
Tryp_SPc 43..314 CDD:214473 63/289 (22%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.