Sequence 1: | NP_729270.1 | Gene: | CG32374 / 38848 | FlyBaseID: | FBgn0052374 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011544118.1 | Gene: | PRSS53 / 339105 | HGNCID: | 34407 | Length: | 623 | Species: | Homo sapiens |
Alignment Length: | 293 | Identity: | 64/293 - (21%) |
---|---|---|---|
Similarity: | 98/293 - (33%) | Gaps: | 110/293 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 PYQCALHYNNYFICGCVILNRRWILTAQHC--------------KIG-------NPGRYTVRAGS 129
Fly 130 TQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKL-----KTPLNVGRCVQKVKLPSTRTKRFP- 188
Fly 189 --KCYLASGWGLTSANAQNVQRYLRGVIVC----KVSRAKC------------------------ 223
Fly 224 --------QQDYRGTGIKIYKQ-------------MICAKRKN--RDTCSGDSGGPLV-----HN 260
Fly 261 GVLYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32374 | NP_729270.1 | Tryp_SPc | 73..292 | CDD:214473 | 63/290 (22%) |
Tryp_SPc | 74..295 | CDD:238113 | 64/293 (22%) | ||
PRSS53 | XP_011544118.1 | Tryp_SPc | 42..316 | CDD:238113 | 64/291 (22%) |
Tryp_SPc | 43..314 | CDD:214473 | 63/289 (22%) | ||
Tryp_SPc | 359..>512 | CDD:304450 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165149426 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24276 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |