DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP007262

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_564960.3 Gene:AgaP_AGAP007262 / 3290331 VectorBaseID:AGAP007262 Length:316 Species:Anopheles gambiae


Alignment Length:273 Identity:76/273 - (27%)
Similarity:124/273 - (45%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 INALEAQDYL------PT---------RIVNGKKIKCSRAPYQCAL--HYNN-YFICGCVILNRR 107
            :..:|..|::      ||         |||||::.:..:.|||.||  .:|: ..:||..|:.:|
Mosquito    38 VRPIEEFDHIKAHFRTPTTATQNTPNRRIVNGQEARPGQFPYQVALLGQFNSGVGLCGASIITQR 102

  Fly   108 WILTAQHC-KIGNPGRYTVRAGSTQQRRGGQLRHVQK------------TVCHPNYSEYTMKNDL 159
            ::|||.|| .||......|..|:.  ..|...|.:::            .:.||.|..:.::||:
Mosquito   103 YVLTAAHCVYIGVDASTPVANGTA--ILGAHNRMIEEPSQQRITFSASGVIGHPGYDLFDVRNDI 165

  Fly   160 CMMKLKTPLNVGRCVQKVKLPS-TRTKRFPKCY-LASGWGLTSANAQNVQRYLRGVIVCKVSRAK 222
            .:::|..|:.....:|.::||. :.|:.|.... ..||:|:.|.....:...|..|:...::.|.
Mosquito   166 AVVRLDEPILYTDRIQPIRLPGRSDTRTFAGLMGTVSGYGVYSTANPGLSDVLNYVLNPVITNAD 230

  Fly   223 CQQDYRGTGIKIYKQMICAKRK-NRDTCSGDSGGPLV--HNG--VLYGITSFGI--GCASAKYPG 280
            |:..:.|....|..|.:|.... .|..|:.||||||.  .||  :..|:.|||.  ||.:. .|.
Mosquito   231 CRAAWSGFEWLIEPQNVCQSGDGGRSACNSDSGGPLTVQDNGESLQVGVVSFGSAGGCDNG-IPT 294

  Fly   281 VYVNVLQYTRWIK 293
            |:..|..|..||:
Mosquito   295 VFARVTYYLDWIE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 70/243 (29%)
Tryp_SPc 74..295 CDD:238113 71/245 (29%)
AgaP_AGAP007262XP_564960.3 Tryp_SPc 65..306 CDD:214473 70/243 (29%)
Tryp_SPc 66..309 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.