DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG4653

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:227 Identity:70/227 - (30%)
Similarity:112/227 - (49%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PYQCALHYNNYFICGCVILNRRWILTAQHC-KIGN-----PGR-YTVRAGSTQQRRGGQLRHVQK 143
            |:..:|..|...:||..::..:|||||.|| .:|.     |.: |.||.||.|:..||||..:.|
  Fly    37 PHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSK 101

  Fly   144 TVCHPNY--SEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGLTSANAQNV 206
            .:.|.||  |:....|||.:::|:|.:.:......:.|.:.|.....: .:.||||.:..:. ::
  Fly   102 IIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQ-IIFSGWGSSQVDG-SL 164

  Fly   207 QRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQ---MICAKRKNRD---TCSGDSGGPLVHNGVLYG 265
            ...|:......:|.:.||.:       :|.|   ::|....:.|   .||||:|.|..:|..|.|
  Fly   165 SHVLQVATRQSLSASDCQTE-------LYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVG 222

  Fly   266 ITSFGI-GCASAKYPGVYVNVLQYTRWIKKVA 296
            |.:|.: ||.| :.|..||:|.|:..||.:.|
  Fly   223 IAAFFVSGCGS-EQPDGYVDVTQHLEWINENA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 67/221 (30%)
Tryp_SPc 74..295 CDD:238113 69/224 (31%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/224 (31%)
Tryp_SPc 30..249 CDD:214473 67/221 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.