DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and sphe

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:263 Identity:70/263 - (26%)
Similarity:120/263 - (45%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IKPQTFLPGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWI 109
            ::|:..:.|.|... |:....||.    ||:.|:....:...:..:|..:|..:||..||::..|
  Fly     2 MQPRLVILGLIGLT-AVGMCHAQG----RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKI 61

  Fly   110 LTAQHC-----KIGNPGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLN 169
            ||..||     |:.:..|...|.|||.|..||::.:|:....||:|  |.:.|:|.::.|.:.|.
  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELT 124

  Fly   170 VGRCVQKV-------KLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDY 227
            ....:..:       .||:..::     .:.:|||.||....:.:  :|.:.:.....|.|...|
  Fly   125 YTDRITAIPLVASGEALPAEGSE-----VIVAGWGRTSDGTNSYK--IRQISLKVAPEATCLDAY 182

  Fly   228 RGTGIKIYKQMIC-AKRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRW 291
            ....    :|..| |......||.||.||..::...|.|:|:|.:|...::||.|:|.:..|..|
  Fly   183 SDHD----EQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADW 243

  Fly   292 IKK 294
            |::
  Fly   244 IQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 62/231 (27%)
Tryp_SPc 74..295 CDD:238113 63/234 (27%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/218 (28%)
Tryp_SPc 42..244 CDD:214473 59/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.