DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG33159

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:223 Identity:82/223 - (36%)
Similarity:118/223 - (52%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGN-PGRYTVRAGSTQ-QRR 134
            ||||.||:...|..||...|..|.|||||..:::.|.:|:|.||..|: |..:||.||::: .:.
  Fly    24 TRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQE 88

  Fly   135 GGQLRHVQKTVCHPNYSEYTMKNDLCMMKLK-----TPLNVGRCVQKVKLPSTRTKRFPKCYL-A 193
            ...:|:|......|:||......|:.:::|:     ||..|      ..:...|.......|. .
  Fly    89 APVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKV------ATISPCRNPPEGNAYARI 147

  Fly   194 SGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAK-RKNRDTCSGDSGGPL 257
            ||||:|..|.:.....:|..:|..:..|:|:..|.|.| ::...|:||. |..||:|||||||||
  Fly   148 SGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYG-QLSDSMLCAAVRGLRDSCSGDSGGPL 211

  Fly   258 VHNGVLYGITSFGIGCASAKYPGVYVNV 285
            |:.|.:.||.|:|.|||...:||||.||
  Fly   212 VYRGQVCGIVSWGFGCARPSFPGVYTNV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 81/222 (36%)
Tryp_SPc 74..295 CDD:238113 80/221 (36%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 81/222 (36%)
Tryp_SPc 26..251 CDD:238113 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.