DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG31681

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:238 Identity:89/238 - (37%)
Similarity:126/238 - (52%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGN--PGRYTVRAGSTQQRRG 135
            |||.|..|.....|:|.::..|:...||.||.:.|.||||.|| :.|  ....:|||||:...:|
  Fly    28 RIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHC-LSNVTVTDLSVRAGSSYWSKG 91

  Fly   136 GQLRHVQKTVCHPN-----YSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASG 195
            ||:..|.||:.||.     |:.|    |:.::.|:.||.:|..|:|:.| :.:|.......|.||
  Fly    92 GQVLKVLKTIAHPKYVPKLYNPY----DIAVLILEAPLRLGGTVKKIPL-AEQTPVAGTIVLTSG 151

  Fly   196 WGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLVH- 259
            ||.|..|:..:...|:||.|..::|..|.:.|:...|.|  .||||..:..|||.|||||||:. 
  Fly   152 WGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITI--DMICADGQRWDTCQGDSGGPLIET 214

  Fly   260 ----NGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVAKK 298
                :..|.|:.|:|.||.:  .||||.::..:..|||...||
  Fly   215 TKGGHRQLIGMVSWGDGCGT--NPGVYEDIAFFHNWIKYTVKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 84/230 (37%)
Tryp_SPc 74..295 CDD:238113 86/232 (37%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 84/230 (37%)
Tryp_SPc 29..250 CDD:238113 84/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.