DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG31267

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:233 Identity:58/233 - (24%)
Similarity:97/233 - (41%) Gaps:8/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EAQDYLPTRIVNGKKIKCSRAPYQCALH--YNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRA 127
            |..:...:|||.|::.....|||..:|.  |.|:|..|.:| :.:|::||..|..|.........
  Fly    36 ETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSII-HDQWVITAASCLAGLRKNNVQVV 99

  Fly   128 GSTQQRRG--GQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKC 190
            .:|....|  |.:..|:..|.|.|:......||:.::|.....:.....|.:.:.........:.
  Fly   100 TTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGET 164

  Fly   191 YLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGG 255
            ....|:|.|.... :....|:.:.|..|:..||...|.||.......:....:.....|.||:||
  Fly   165 LTMYGYGSTEIGG-DFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGG 228

  Fly   256 PLVHN-GVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292
            |:|.: |.|.|:.::|:.|... :|.|:..:..|..||
  Fly   229 PIVDSRGRLVGVGNWGVPCGYG-FPDVFARISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 55/223 (25%)
Tryp_SPc 74..295 CDD:238113 56/224 (25%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 55/223 (25%)
Tryp_SPc 45..268 CDD:238113 56/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.