DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG32523

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:259 Identity:79/259 - (30%)
Similarity:122/259 - (47%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QTFLPGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTA 112
            |..|..:::.|.:.:|:|      .|||.|.|.|..:.|:|.:|.......||.||::...::||
  Fly    17 QVILGQDVAQNQSESAIE------PRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITA 75

  Fly   113 QHC-KIGN----PGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGR 172
            .|| |.||    ...::::|||......|....|.:.:.||||:. ...|||.:::|::||....
  Fly    76 GHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYAT-GGHNDLAVLRLQSPLTFDA 139

  Fly   173 CVQKVKLPSTRTKRFPKCYLA--SGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIY 235
            .:..::|   .|:..|.|...  |||| ..|....:...|..|.|..:||..|:..:..   ::.
  Fly   140 NIAAIQL---ATEDPPNCVAVDISGWG-NIAEKGPLSDSLLFVQVTSISRGACRWMFYS---RLP 197

  Fly   236 KQMIC-AKRKNRDTCSGDSGGPLVHNGVLYGITS--FGIGCASAKYPGVYVNVLQYTRWIKKVA 296
            :.||| ...||...|.||||||..:.|.:.|:.|  .|.||..|. |..|:.:.:...||.:.|
  Fly   198 ETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWIAEKA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 71/228 (31%)
Tryp_SPc 74..295 CDD:238113 72/230 (31%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/228 (31%)
Tryp_SPc 37..219 CDD:238113 59/189 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.