DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG32376

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:290 Identity:180/290 - (62%)
Similarity:219/290 - (75%) Gaps:14/290 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GGQSK------NWSGYYVDNGTHYLLYEGPRIKPQTFLP----GNISTNPAINALEAQDYLPTRI 74
            |.:|:      :|||||.|||||||||.    ||:...|    ||||:||.|||||||:..||||
  Fly     6 GSESEGRERDPSWSGYYKDNGTHYLLYG----KPEDIAPTPNFGNISSNPFINALEAQESFPTRI 66

  Fly    75 VNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAGSTQQRRGGQLR 139
            ||||:|.|:.||:|.:|||..||:|||||:|:.|||||.||..|.|.:||||.||.|||||||||
  Fly    67 VNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEKYTVRVGSDQQRRGGQLR 131

  Fly   140 HVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGLTSANAQ 204
            ||:|.|....|::|||::||.|||||:|:..|:||:.||||||:|.:|||.::.||||:||||||
  Fly   132 HVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGITSANAQ 196

  Fly   205 NVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLVHNGVLYGITSF 269
            |||||||.|.:..:.|:|||:.|:..|:||||.||||.|.|:|:|||||||||...||||||.|:
  Fly   197 NVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNKDSCSGDSGGPLTSRGVLYGIVSW 261

  Fly   270 GIGCASAKYPGVYVNVLQYTRWIKKVAKKY 299
            |||||:..|||||||..:|..|||||..||
  Fly   262 GIGCANKNYPGVYVNCKRYVPWIKKVIHKY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 139/218 (64%)
Tryp_SPc 74..295 CDD:238113 141/220 (64%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 139/218 (64%)
Tryp_SPc 66..287 CDD:238113 141/220 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4883
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 1 1.000 - - H136035
Inparanoid 1 1.050 139 1.000 Inparanoid score I4419
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016607
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.960

Return to query results.
Submit another query.