DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG14780

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:259 Identity:79/259 - (30%)
Similarity:119/259 - (45%) Gaps:31/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AINALEAQDYLPTRIVNGKKIKCSRAPYQCAL----HYNNY---FICGCVILNRRWILTAQHCKI 117
            |..|.:.|:...:||:||...|.....:..::    |.||:   .|||..::..|.:|||.||..
  Fly    19 ACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLY 83

  Fly   118 GNPGRYTVRAGS----------TQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKT--PLNV 170
            .|..:...||..          .:.|.|..:..|........:|..:|::|:.::.|:|  |::.
  Fly    84 NNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSP 148

  Fly   171 G----RCVQKVKLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTG 231
            |    ..|..::|....|.....|.:| |||.|..:  ::...|....|..:....|:..||.  
  Fly   149 GGGVHLTVAPIQLAGQITPPGKLCQVA-GWGRTEQS--SLSNILLTANVSTIRHQTCRMIYRS-- 208

  Fly   232 IKIYKQMICAKR--KNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293
             .:...|:||.|  ...|:|.|||||||||.|.|.|:.|:|.|||....|||||:|..|.:||:
  Fly   209 -GLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 74/243 (30%)
Tryp_SPc 74..295 CDD:238113 75/245 (31%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 74/243 (30%)
Tryp_SPc 33..271 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.