DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Klk1c8

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:241 Identity:78/241 - (32%)
Similarity:124/241 - (51%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAGSTQQRRGG 136
            :||:.|...:.:..|:|.|:::.|...||.|:::..|::||.||...|...:..|....:.....
  Rat    23 SRIIGGFNCEKNSQPWQVAVYHFNEPQCGGVLIHPSWVITAAHCYSVNYQVWLGRNNLLEDEPFA 87

  Fly   137 QLRHVQKTVCHPNYS-----EYTMK------NDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKC 190
            |.|.|.::..||.::     .:|.|      |||.::.||||.::...|:.:.||:...|....|
  Rat    88 QHRLVSQSFPHPGFNLDIIKNHTRKPGNDYSNDLMLLHLKTPADITDGVKVIDLPTEEPKVGSTC 152

  Fly   191 YLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKN--RDTCSGDS 253
             |.||||..:.........|:.|.:..:|..||.:.|..   ::...|:||...:  :|.|.|||
  Rat   153 -LTSGWGSITPLKWEFPDDLQCVNIHLLSNEKCIKAYND---EVTDVMLCAGEMDGGKDICKGDS 213

  Fly   254 GGPLVHNGVLYGITSFG-IGCASAKYPGVYVNVLQYTRWIKKVAKK 298
            ||||:.:|||.||||:| :.|.....|.||..::::|.|||||.|:
  Rat   214 GGPLICDGVLQGITSWGSMPCGEPNKPSVYTKLIKFTSWIKKVMKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 72/232 (31%)
Tryp_SPc 74..295 CDD:238113 74/234 (32%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 72/232 (31%)
Tryp_SPc 25..256 CDD:238113 74/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4419
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.