DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Klk1c12

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:261 Identity:81/261 - (31%)
Similarity:129/261 - (49%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYT 124
            ::..::|.....:|:|.|.|.:.:..|:|.|:  .|.::||.|:::..|::||.||.......|.
  Rat    11 SVGRIDAAPPGQSRVVGGYKCEKNSQPWQVAV--INRYLCGGVLIDPSWVITAAHCYSHALSNYH 73

  Fly   125 VRAGST---QQRRGGQLRHVQKTVCHPNYSEYTMK-----------NDLCMMKLKTPLNVGRCVQ 175
            |..|..   :.....|.|.|.::..||:|:.:.||           |||.::.|..|.::...|:
  Rat    74 VLLGRNNLFKDEPFAQYRFVNQSFPHPDYNPFFMKNHTLFPGDDHSNDLMLLHLSEPADITDGVK 138

  Fly   176 KVKLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMI- 239
            .:.||:...|....| |||||..|..........|:.|.:..:|..||        ||.:.||: 
  Rat   139 VIDLPTEEPKVGSTC-LASGWSSTKPLEWEFPDDLQCVNINILSNEKC--------IKAHTQMVT 194

  Fly   240 ----CA--KRKNRDTCSGDSGGPLVHNGVLYGITSF-GIGCASAKYPGVYVNVLQYTRWIKKVAK 297
                ||  ....:|||:|||||||:.:|||.||||: .:.|.....|.:|..::::|.|||:|.|
  Rat   195 DVMLCAGELEGGKDTCNGDSGGPLLCDGVLQGITSWSSVPCGETNRPAIYTKLIKFTSWIKEVMK 259

  Fly   298 K 298
            :
  Rat   260 E 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 75/240 (31%)
Tryp_SPc 74..295 CDD:238113 77/242 (32%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4419
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.