DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and LOC286960

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:241 Identity:76/241 - (31%)
Similarity:115/241 - (47%) Gaps:22/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC-------KIGNP 120
            ||...|  ..:||.|........|||.:||......||..:::.:|:|:|.||       ::|..
  Rat    15 ALPVND--DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEH 77

  Fly   121 GRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTK 185
            ..:.:..|.       |....:|.:.||.|::.|:.||:.::|||:|..:...|..|.||.:...
  Rat    78 NIHVLEGGE-------QFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCAS 135

  Fly   186 RFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDT 248
            ...:| |.||||.|.:........|:.:....:|.:.|::.|.|   :|...|.|.  ....:|:
  Rat   136 TDAQC-LVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPG---QITSNMFCLGFLEGGKDS 196

  Fly   249 CSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKK 294
            |.||||||:|.||.:.||.|:|..||....||||..|..|..||::
  Rat   197 CDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 71/227 (31%)
Tryp_SPc 74..295 CDD:238113 73/230 (32%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 71/227 (31%)
Tryp_SPc 24..243 CDD:238113 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.