DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG18420

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:282 Identity:71/282 - (25%)
Similarity:114/282 - (40%) Gaps:52/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLYEGPRIKPQTFLPGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALH-YNNYFICGC 101
            ||...|.:....||.....|...:.       |..||||||....:.:|:...|| .:|.||||.
  Fly    14 LLTVFPLLGSTQFLDSECGTRSPLK-------LGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGG 71

  Fly   102 VILNRRWILTAQHCKIGNPGRYTVRAGSTQQR-RGGQLRH-VQKTVCHPNYSEYTMKNDLCMMKL 164
            .:::||.:|||.||.|.|. ...||.|...:: :|.:..| |.:|..|..|...|..||:.:::|
  Fly    72 TLISRRLVLTAAHCFIPNT-TIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTHANDIALLRL 135

  Fly   165 KTPLNVGRCVQKVKLPSTRTKRFPKCYL----------------ASGWGLTSANAQNVQRYLRGV 213
                 |...|.|..:.       |.|.:                .:|||.|.:...:.:  ||.:
  Fly   136 -----VSNVVYKANIR-------PICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSE--LRTL 186

  Fly   214 IVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGP---LVHNGVLYGITSFGIGCAS 275
            .:.:.....|...      .:.....||...|.:.|.||:|||   :|.....:.....||...:
  Fly   187 DISRQPSKMCAFG------SVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITN 245

  Fly   276 --AKYPGVYVNVLQYTRWIKKV 295
              .:.|.|:.:|:.:..:|:::
  Fly   246 KRCQRPSVFTDVMSHIEFIRRI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 63/242 (26%)
Tryp_SPc 74..295 CDD:238113 63/244 (26%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 63/242 (26%)
Tryp_SPc 43..267 CDD:238113 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.