DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Klk1c2

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:256 Identity:85/256 - (33%)
Similarity:133/256 - (51%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYT 124
            ::..::|.....:|||.|.|.:.:..|:|.|:  .|.::||.|:::..|::||.||...|   |.
  Rat    11 SVGRIDAAPPGQSRIVGGYKCEKNSQPWQVAV--INEYLCGGVLIDPSWVITAAHCYSNN---YQ 70

  Fly   125 VRAGST---QQRRGGQLRHVQKTVCHPNY-----------SEYTMKNDLCMMKLKTPLNVGRCVQ 175
            |..|..   :.....|.|.|:::..||:|           ..:...|||.::.|..|.::...|:
  Rat    71 VLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVK 135

  Fly   176 KVKLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMIC 240
            .:.||:...|....| ||||||.|:.:...|...|:.|.:..:|..||.:.|:.   .:...|:|
  Rat   136 VIDLPTKEPKVGSTC-LASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKD---NVTDVMLC 196

  Fly   241 A--KRKNRDTCSGDSGGPLVHNGVLYGITSFG-IGCASAKYPGVYVNVLQYTRWIKKVAKK 298
            |  ....:|||:|||||||:.:|||.||||.| ..||..|.|.:|..::::|.|||||.|:
  Rat   197 AGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 78/235 (33%)
Tryp_SPc 74..295 CDD:238113 80/237 (34%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4419
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.