DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Prss1

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:235 Identity:87/235 - (37%)
Similarity:121/235 - (51%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAG 128
            ||..|    :||.|........|||.:|: :.|..||..::|.:|:::|.||   ...|..||.|
  Rat    18 LEDDD----KIVGGYTCPEHSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHC---YKSRIQVRLG 74

  Fly   129 --STQQRRGG-QLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKC 190
              :.....|. |..:..|.:.|||||.:|:.||:.::||.:|:.:...|..|.|||.......:|
  Rat    75 EHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQC 139

  Fly   191 YLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDTCSGDS 253
             |.||||.|.:|..|....|:.|....:|:|.|:..|.|   :|...|||.  ....:|:|.|||
  Rat   140 -LISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPG---EITSSMICVGFLEGGKDSCQGDS 200

  Fly   254 GGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293
            |||:|.||.|.||.|:|.|||....||||..|..:..||:
  Rat   201 GGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 82/223 (37%)
Tryp_SPc 74..295 CDD:238113 84/225 (37%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 82/223 (37%)
Tryp_SPc 24..242 CDD:238113 84/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.