DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and svh-1

DIOPT Version :10

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:46 Identity:14/46 - (30%)
Similarity:20/46 - (43%) Gaps:5/46 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLSSVSEDNNSSILVSDGVQDRSSNDFLSLNPPNLSESACVHVYGF 68
            :.:.|.|:.:|...||.  ..|:.....|.||.|.|...|   :||
 Worm   168 IFNKVREERSSGANVSG--SSRTPTHQSSRNPNNTSSCCC---FGF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SR 599..681 CDD:214555
Tryp_SPc 713..945 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.