DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and svh-1

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:264 Identity:73/264 - (27%)
Similarity:117/264 - (44%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 INALEAQDYLPTRIVNGKKIKCSRAPYQCAL-------HYNNYFICGCVILNRRWILTAQHC--- 115
            :||.:|......|:|.|.:......|:..||       |:     ||..||::..::||.||   
 Worm   700 VNARDAAKSRIARVVGGFETVPGAFPWTAALRNKATKAHH-----CGASILDKTHLITAAHCFEE 759

  Fly   116 --KIGNPGRYTVRAG---STQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTP-LNVGRCV 174
              ::.:   |.|..|   :.|.....|:.::|:...:|.|.: ...:|:.::::..| :......
 Worm   760 DERVSS---YEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKD-IFSHDIAILEIPYPGIEFNEYA 820

  Fly   175 QKVKLPSTRTKRFP--KCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQ 237
            |.:.|||......|  :| :.||||  |...:..:| |:..::..::|..|.     ...:||..
 Worm   821 QPICLPSKDFVYTPGRQC-VVSGWG--SMGLRYAER-LQAALIPIINRFDCV-----NSSQIYSS 876

  Fly   238 M----ICA--KRKNRDTCSGDSGGPLV---HNG--VLYGITSFGIGCASAKYPGVYVNVLQYTRW 291
            |    .||  .....|:|.||||||..   .:|  ||.|:.|:|.|||..|.||:|..|..|..|
 Worm   877 MSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSW 941

  Fly   292 IKKV 295
            |..:
 Worm   942 ISAI 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 68/247 (28%)
Tryp_SPc 74..295 CDD:238113 69/249 (28%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 69/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.