DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Klk1b11

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_034770.1 Gene:Klk1b11 / 16613 MGIID:892023 Length:261 Species:Mus musculus


Alignment Length:272 Identity:84/272 - (30%)
Similarity:128/272 - (47%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYT 124
            ::..::|...:.:|||.|...:.:..|:..|::..|.:|||.|:|:|.|:|||.||.:   .:|.
Mouse    11 SLGGIDAAPPVQSRIVGGFNCEKNSQPWHVAVYRYNKYICGGVLLDRNWVLTAAHCHV---SQYN 72

  Fly   125 VRAGST---QQRRGGQLRHVQKTVCHPNYS-----------EYTMKNDLCMMKLKTPLNVGRCVQ 175
            |..|.|   |:....|.|.|.|:..||:|:           |....|||.:::|..|.::...|:
Mouse    73 VWLGKTKLFQREPSAQHRMVSKSFPHPDYNMSLLIIHNPEPEDDESNDLMLLRLSEPADITDAVK 137

  Fly   176 KVKLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQ--QDYRGTGIKIYKQM 238
            .:.||:...|....| |.||||                   .::..|.|  .|.:...||:....
Mouse   138 PIALPTEEPKLGSTC-LVSGWG-------------------SITPTKFQTPDDLQCVSIKLLPNE 182

  Fly   239 ICAKRKN----------------RDTCSGDSGGPLVHNGVLYGITSFG-IGCASAKYPGVYVNVL 286
            :|.|..|                :|||.|||||||:.:|||:|||::| |.|.....||||..::
Mouse   183 VCVKNHNQKVTDVMLCAGEMGGGKDTCKGDSGGPLICDGVLHGITAWGPIPCGKPNTPGVYTKLI 247

  Fly   287 QYTRWIKKVAKK 298
            ::|.|||....|
Mouse   248 KFTNWIKDTMAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 79/251 (31%)
Tryp_SPc 74..295 CDD:238113 81/253 (32%)
Klk1b11NP_034770.1 Tryp_SPc 24..253 CDD:214473 79/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5616
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.