DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and PRSS36

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:244 Identity:83/244 - (34%)
Similarity:117/244 - (47%) Gaps:23/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGN-----PGRYTVRAGSTQQ 132
            |||.|...:....|:|.:||:....|||..::...|:|:|.||.:.|     ...::|..|...|
Human    46 RIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLGVHSQ 110

  Fly   133 ---RRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLP--STRTKRFPKCYL 192
               ..|...|.|...|...|||:..:..||.:::|.:|.::|..|..|.||  |.|......|: 
Human   111 DGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWPVCLPRASHRFVHGTACW- 174

  Fly   193 ASGWG-LTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTG-----IKIYKQMICA--KRKNRDTC 249
            |:||| :..|:...:...|:.|.:..:..|.||..|...|     ::|...|:||  ....||||
Human   175 ATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTC 239

  Fly   250 SGDSGGPLV--HNGVLY--GITSFGIGCASAKYPGVYVNVLQYTRWIKK 294
            .||||||||  ..|..:  ||||||.||.....|||:..|..|..||::
Human   240 QGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWIRE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 81/240 (34%)
Tryp_SPc 74..295 CDD:238113 82/243 (34%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 81/240 (34%)
Tryp_SPc 47..289 CDD:238113 82/243 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.