DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP006087

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_316143.4 Gene:AgaP_AGAP006087 / 1276758 VectorBaseID:AGAP006087 Length:342 Species:Anopheles gambiae


Alignment Length:249 Identity:77/249 - (30%)
Similarity:109/249 - (43%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LPTRIVNGKKIKCSRAPYQCALH---------YNNYFICGCVILNRRWILTAQHCKIGNPGRYTV 125
            |..|||.|:......||:..:|.         :.:...||..::....:|||.||....|....|
Mosquito    59 LGERIVGGRNALYGDAPFHVSLRSLYHERRHGFGSGLFCGGSLITASRVLTASHCFTTKPSNMVV 123

  Fly   126 RAG---------STQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPS 181
            .||         ..||||      |.:.:.||.:...|:..|:.::.|.:|...|..||.:.|.:
Mosquito   124 VAGVLNRFDRSKRMQQRR------VLRYLSHPGWHARTLAADIGLVALVSPFQCGGGVQPIALAN 182

  Fly   182 TRTKRFPKCYLASGWGLTSANAQNVQRY----LRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAK 242
            ........|.: .|||.|....:  ||:    |:...|..:...:|.:... |.:.:....:||.
Mosquito   183 RPPVDGEPCTI-YGWGQTEEGRK--QRFQPVCLQKASVSVLGLERCNRSLH-TVVTVPDGTLCAG 243

  Fly   243 RKNR--DTCSGDSGGPLV--HNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292
            ..:.  |:|.||||||||  ..|.||||.|||.||..|.:||||.:|.||..||
Mosquito   244 SFDGGVDSCQGDSGGPLVCGGGGALYGIVSFGWGCGRANFPGVYTDVFQYRGWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 74/244 (30%)
Tryp_SPc 74..295 CDD:238113 75/245 (31%)
AgaP_AGAP006087XP_316143.4 Tryp_SPc 62..297 CDD:214473 74/244 (30%)
Tryp_SPc 63..297 CDD:238113 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.