DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP005791

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_315804.4 Gene:AgaP_AGAP005791 / 1276457 VectorBaseID:AGAP005791 Length:248 Species:Anopheles gambiae


Alignment Length:231 Identity:43/231 - (18%)
Similarity:89/231 - (38%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VNGKKIKCSRAPYQCALHYNNYFICG-CVILNRRWILTAQHCKIGNP-GRYTVRAGSTQQRRGGQ 137
            :.|..:..::.|:...:......|.| ..||:..|:||:.......| ..|::..||.:......
Mosquito    21 IGGTDVSIAQYPFVAGILLQRSTIIGNGAILSPNWVLTSASAVYSTPDSDYSIATGSEELLTPAA 85

  Fly   138 LRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGLTSAN 202
            ...||:...||.:..:..  ::.::|:...:..|..||.:.:.:|..:......:     |:...
Mosquito    86 QYQVQRIFRHPEFVGWDY--NVALVKVSGKIAFGDTVQSIAIATTDPETVNDATM-----LSYGK 143

  Fly   203 AQNVQRYLRGVIVCKVS-RAKC---QQDYRGTGIKIYKQ----MICAKRKNRDTCSGDSGGPLVH 259
            .::...:||......:| ...|   .|:|:...: |::.    :|......:.....|:|.|||.
Mosquito   144 NEDGTSHLRSATYTLISDNDDCVPLLQEYQAKEV-IWQHHGFCLIPPPGTQQGQWYNDAGAPLVA 207

  Fly   260 NGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKV 295
            :|.||.:.:|...........|...:..:..||:.:
Mosquito   208 DGQLYAVFAFAENEGGTNEGSVATRLTSFAGWIQSI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 41/226 (18%)
Tryp_SPc 74..295 CDD:238113 43/229 (19%)
AgaP_AGAP005791XP_315804.4 Tryp_SPc 21..243 CDD:304450 43/229 (19%)
Tryp_SPc 21..240 CDD:214473 41/226 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.