DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Try5

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:226 Identity:81/226 - (35%)
Similarity:118/226 - (52%) Gaps:13/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAG--STQQRRG 135
            :||.|...:.:..|||.:|: :.|..||..::|.:|:::|.||   ...|..||.|  :.....|
Mouse    23 KIVGGYTCRENSIPYQVSLN-SGYHFCGGSLINDQWVVSAAHC---YKTRIQVRLGEHNINVLEG 83

  Fly   136 G-QLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGLT 199
            . |..:..|.:.|||::..|:.||:.::||.:|:.:...|..|.|||:......:| |.||||.|
Mouse    84 NEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVALPSSCAPAGTQC-LISGWGNT 147

  Fly   200 SANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDTCSGDSGGPLVHNGV 262
            .:...|....|:.:....:.:|.|:..|.|   ||...|||.  ....:|:|.||||||:|.||.
Mouse   148 LSFGVNNPDLLQCLDAPLLPQADCEASYPG---KITNNMICVGFLEGGKDSCQGDSGGPVVCNGQ 209

  Fly   263 LYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293
            |.||.|:|.|||....||||..|..|..||:
Mouse   210 LQGIVSWGYGCALKDNPGVYTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 79/223 (35%)
Tryp_SPc 74..295 CDD:238113 81/225 (36%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 79/223 (35%)
Tryp_SPc 24..242 CDD:238113 81/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.