DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and f12

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:325 Identity:92/325 - (28%)
Similarity:138/325 - (42%) Gaps:54/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WILVVGGQSKNWSGYYVDNGTHYLLYEGPRIKPQTFLPGNISTNPAINALEAQDY---------L 70
            |..|:..|..:|....:...|.......|....:|..|...|.:.|.....:.|.         |
 Frog   277 WCFVMKEQRLSWEHCLIPRCTQLAGTTAPPKVTKTPSPTKSSNHSASTPSPSNDTQGPVDGRIDL 341

  Fly    71 PT--------------RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPG 121
            |.              |||.|.....:..||..||:.:|:| ||..:::..||:||.||....|.
 Frog   342 PVDCGRKFQKTPSIMPRIVGGLVALPASHPYIAALYIDNHF-CGGSLISPCWIVTAAHCLDQRPN 405

  Fly   122 RYTVRAGSTQQRRGGQLRH-----VQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRC-------V 174
            ...:.....|.|.....:|     |:|.:.|..|...|:::|:.::|:|: :| |.|       |
 Frog   406 VTKISVVLGQSRFNTTDQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKS-IN-GLCASEFSQFV 468

  Fly   175 QKVKLP-----STRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKI 234
            |.:.||     :..||   :|.:| |||.....|::...:|:...:..:...:||.. ...|.::
 Frog   469 QPICLPQQFKMAESTK---QCVVA-GWGHQYEGAEHYAFFLQEASMPIIPYTQCQSP-SVHGDRM 528

  Fly   235 YKQMICA--KRKNRDTCSGDSGGPLV--HNG--VLYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293
            ...|:||  .....|.|.||||||||  .:|  .|:|:.|:|.|||....||||..|..||.||:
 Frog   529 LPGMLCAGFMEGGVDACQGDSGGPLVCEVDGRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWIR 593

  Fly   294  293
             Frog   594  593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 77/241 (32%)
Tryp_SPc 74..295 CDD:238113 78/243 (32%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527 4/20 (20%)
Tryp_SPc 359..595 CDD:238113 78/243 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.