DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and gzma

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:234 Identity:74/234 - (31%)
Similarity:114/234 - (48%) Gaps:18/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 IVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNP----GRYTVRAGSTQQRR 134
            |::|::......||. |..|:....||..::.:.|:|||.||.:.|.    |.:.|::...:|:|
 Frog    35 IIDGREAASHSRPYM-AYIYSRTGSCGGTLIKQNWVLTAAHCVVNNSEVILGAHKVKSRENEQQR 98

  Fly   135 GGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPST--RTKRFPKCYLASGWG 197
            ..    |.:.:.||.:......:|:.::::|....:.:.|..:|||:|  ..|....|..| |||
 Frog    99 FS----VARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDMDVKPGSSCSTA-GWG 158

  Fly   198 LTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA-----KRKNRDTCSGDSGGPL 257
            :|..|.:.....||.|.|..|.|..|.:.|:....:|...|:||     ..|..|.|.|||||||
 Frog   159 VTKPNGKTPSDVLREVNVTVVDRGTCNKIYKKFKTEISTNMLCAGAPKKSDKKYDACQGDSGGPL 223

  Fly   258 VHNGVLYGITSFGIGCASAKYPGVYVNV-LQYTRWIKKV 295
            :......||.|||..|...||||:|..: .:|.:||:.|
 Frog   224 ICGKEFSGIVSFGKKCGDPKYPGIYTRLTARYLQWIRDV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 71/229 (31%)
Tryp_SPc 74..295 CDD:238113 73/232 (31%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136035
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.