DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Prss36

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:261 Identity:86/261 - (32%)
Similarity:123/261 - (47%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHC------VQ 68
            |.||..    .|..|||||.:......||..|:...|.:.|..:||...|:::|.||      ::
Mouse    37 LDCGRP----EPSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLE 97

  Fly    69 YPDSYSVRAGSTFTDG---GGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLP 130
            ..|..||..|....||   |...|:|.::::..:::...|..|:|||:|.....||.:::.|.||
Mouse    98 PADELSVLLGVHSQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLP 162

  Fly   131 LPSLNILPRTLLVA-GWGNPDATDSESEPR---LRGTVVKVINQRLCQRLYSHLHRP-------- 183
            ..|......|...| |||  |..::...|.   |:...::::.:..||.|||   ||        
Mouse   163 RASHLFAHGTACWATGWG--DVQEAVPLPLPWVLQEVELRLLGEAACQCLYS---RPGPFNLTFQ 222

  Fly   184 ITDDMVCA---AGAGRDHCYGDSGAPLV-HRGSSY---GIVSFAHGCADPHFPGVYTRLANYVTW 241
            :...|:||   ||. ||.|.||||.||| ..|..:   ||.||..||...:.|||:|.:|.|.:|
Mouse   223 LLPGMLCAGYPAGR-RDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESW 286

  Fly   242 I 242
            |
Mouse   287 I 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 80/245 (33%)
Tryp_SPc 25..242 CDD:238113 79/244 (32%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 81/246 (33%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.