DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG17242

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:248 Identity:71/248 - (28%)
Similarity:116/248 - (46%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV 67
            :|..||||:   ..:.::...:.:|     |...||.||:.::..:.|...:.:...::|...||
  Fly     2 LLKGILLLV---SIAQIAADFKSIG-----IEQAPWQASVQINDKHHCGGVIYSEDIILTIAECV 58

  Fly    68 QYP--DSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTL---ENDIALLKLDKSFTLGGNIQVV 127
            :..  :..|||.||...:.||      :|:......|:.|   .:|:|:|:|.....|.|.|:.:
  Fly    59 RKARLEFISVRVGSAQENAGG------TVLKVEKMRLQVLGLRPSDVAILQLRSPLYLDGGIRAI 117

  Fly   128 KLPLPSLNILPRT-LLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCA 191
              ||.::.::|.| ..|:|||...|.:..||..|| ..||:.:|.:|....:...|.::...:||
  Fly   118 --PLATIPLVPGTNASVSGWGQLSAMNPSSEVLLR-VDVKIQDQLMCATNLALKGRLMSVGEICA 179

  Fly   192 AGAGR--DHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
            |.||.  ..|.|..|.|||.....|||:|:...|...:...||..:|.:..||
  Fly   180 APAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 64/225 (28%)
Tryp_SPc 25..242 CDD:238113 64/224 (29%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 65/218 (30%)
Tryp_SPc 24..232 CDD:214473 63/216 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.