DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG34458

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:250 Identity:73/250 - (29%)
Similarity:125/250 - (50%) Gaps:13/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NILALILLLIC---GHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTA 63
            |::.|.:||:.   .|....::.:.||:||........|...|:.::|.:.|..:||:...:|||
  Fly     6 NLVKLSILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTA 70

  Fly    64 GHCV--QYPDSYSVRAGST-FTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQ 125
            .||.  |.|.......|:. .:.|.||..|:...|:||.:|.::.:.|::|:||.....:||.:|
  Fly    71 AHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQ 135

  Fly   126 VVKLPLPSLNILPRTL-LVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMV 189
            .::|.....|....|: :::|:|..: .:.:...||:...|::.::..|.   |.....:||.||
  Fly   136 TIQLADSDSNYAADTMAMISGFGAIN-QNLQLPNRLKFAQVQLWSRDYCN---SQNIPGLTDRMV 196

  Fly   190 CAA-GAGR-DHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
            ||. .:|: ..|.||||.||...|..:|:||:..||.....|.:||.:....:||
  Fly   197 CAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 66/223 (30%)
Tryp_SPc 25..242 CDD:238113 65/222 (29%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 66/223 (30%)
Tryp_SPc 32..254 CDD:238113 66/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.