DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:101 Identity:42/101 - (41%)
Similarity:56/101 - (55%) Gaps:10/101 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 SEPR-LRGTVVKVINQRLCQRLYSHLHRPITDDMVCAA--GAGRDHCYGDSGAPLVHRGSSY--- 214
            |.|| |:.|||.|:....|..|   |...|||:|:||.  ..|:|.|.||||.|:|.:..|.   
Zfish    11 SHPRTLQQTVVPVVINSDCNNL---LGATITDNMMCAGLLQGGKDTCQGDSGGPMVSQQCSVWVQ 72

  Fly   215 -GIVSFAHGCADPHFPGVYTRLANYVTWIFNVLEND 249
             ||:|..|.|..|:.||||||::.|..||.:.:..:
Zfish    73 SGIISKGHDCGQPYEPGVYTRVSQYQNWIMSSINQN 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 40/92 (43%)
Tryp_SPc 25..242 CDD:238113 40/92 (43%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 42/94 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.