DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and zgc:100868

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:257 Identity:90/257 - (35%)
Similarity:127/257 - (49%) Gaps:43/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYP----- 70
            :||  |:.|:  .|||||...|:...||..|:...|::.|..:||.:.|::||.||...|     
Zfish    27 VCG--TAPLN--SRIVGGQNAPVGAWPWQVSLQRDGSHFCGGSLINNQWILTAAHCFPNPSTTGL 87

  Fly    71 ------------DSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGN 123
                        :|||:.:.            |.::|.||::|..|.:|||.||:|..:.:....
Zfish    88 LVYLGLQKLASFESYSMSSA------------VSNIIKHPNYNSDTEDNDITLLQLASTVSFSNY 140

  Fly   124 IQVVKLPLPSLNILPRTLL-VAGWGNPDATDSESEP-RLRGTVVKVINQRLCQRLYSHLHRPITD 186
            |:.:.|..........||: :.||||.....|...| .|:...|.::..|.|..||.  ...|||
Zfish   141 IRPICLAASDSTFFNGTLVWITGWGNTATGVSLPSPGTLQEVQVPIVGNRKCNCLYG--VSKITD 203

  Fly   187 DMVCAA--GAGRDHCYGDSGAPLVHRGSSY----GIVSFAHGCADPHFPGVYTRLANYVTWI 242
            :||||.  ..|:|.|.||||.|:|.:..|.    |||||..|||.|:|||||||::.|.:||
Zfish   204 NMVCAGLLQGGKDSCQGDSGGPMVSKQGSVWIQSGIVSFGTGCAQPNFPGVYTRVSKYQSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 84/242 (35%)
Tryp_SPc 25..242 CDD:238113 83/241 (34%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 84/242 (35%)
Tryp_SPc 37..267 CDD:238113 85/243 (35%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.