DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Tmprss2

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:252 Identity:85/252 - (33%)
Similarity:121/252 - (48%) Gaps:31/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYPDSYSVR 76
            ||  ..::..|.|||||:.......||..|:.|.|.:.|..::||..|:|||.|||:.|.| |.|
Mouse   243 CG--VRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLS-SPR 304

  Fly    77 AGSTFTDGG---------GQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLP 132
            ..:.|  .|         |.|..|..||.||:::.:|..|||||:||.........::.|.||.|
Mouse   305 YWTAF--AGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVKPVCLPNP 367

  Fly   133 SLNI-LPRTLLVAGWGNPDAT--DSESEPRLRGTVVKVINQRLC--QRLYSHLHRPITDDMVCAA 192
            .:.: |.:...::|||   ||  ..::...|...:|.:|....|  :.:|::|   ||..|:||.
Mouse   368 GMMLDLDQECWISGWG---ATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNL---ITPAMICAG 426

  Fly   193 --GAGRDHCYGDSGAPLVHRGSS----YGIVSFAHGCADPHFPGVYTRLANYVTWIF 243
              ....|.|.||||.|||...:.    .|..|:..|||....||||..:..:..||:
Mouse   427 FLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIY 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 80/237 (34%)
Tryp_SPc 25..242 CDD:238113 79/236 (33%)
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:373897 2/5 (40%)
Tryp_SPc 254..485 CDD:238113 81/239 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.