DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and prtn3-like.2

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_002940708.1 Gene:prtn3-like.2 / 496767 XenbaseID:XB-GENE-5764783 Length:312 Species:Xenopus tropicalis


Alignment Length:260 Identity:94/260 - (36%)
Similarity:142/260 - (54%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGH 65
            |.:|.|:.:::|....|..|   |||||.|...|..|::||:.:.|.:.|..|||...|::||.|
 Frog    61 MQLLVLLTVVLCSCPFSGAS---RIVGGREARAHSRPYIASLQIRGFHFCGGALINEKWVLTAAH 122

  Fly    66 CVQYP--DSYSVRAGS---TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQ 125
            |::..  ||..|..|:   ...|...|...|...:.:|::|..|.:|||.||||:.|..:...::
 Frog   123 CMEDTPVDSVRVVLGAHNLQRPDSLVQEFRVQESVQNPEYNPTTFQNDIHLLKLNDSAVITSGVR 187

  Fly   126 VVKLPLPSLNILPRT-LLVAGWGNPDATDSESEPR-LRGTVVKVINQRLCQRLYSHLHRPITDDM 188
            .::||:|:.::.||: ..|||||  |..|..:.|| |..|...:|:::.|.|.:.   ..||:.|
 Frog   188 TIRLPVPNSDVAPRSNCSVAGWG--DINDFGTSPRALMQTNADIISRQACNRSWG---GAITNTM 247

  Fly   189 VCAAGAG---RDHCYGDSGAPLVHRGSSYGIVSFA-HGCADPHFPGVYTRLANYVTWIFNVLEND 249
            :|||..|   :..|.||||.|||.|....|.|||: ..|.:..||.||||:::|:.||..|:..:
 Frog   248 LCAATPGVLAKGFCSGDSGGPLVCRNRLEGAVSFSGRFCGNAMFPDVYTRVSSYLPWIETVIRQN 312

  Fly   250  249
             Frog   313  312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 85/228 (37%)
Tryp_SPc 25..242 CDD:238113 84/227 (37%)
prtn3-like.2XP_002940708.1 Tryp_SPc 81..305 CDD:214473 85/228 (37%)
Tryp_SPc 82..308 CDD:238113 86/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4319
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D526726at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto102878
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.