DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Gm5771

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:244 Identity:90/244 - (36%)
Similarity:122/244 - (50%) Gaps:14/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQY 69
            ||:.|.:.|...:.....::||||.....:..|:..|:. .|.:.|..:||...|:|:|.||  |
Mouse     3 ALLFLALVGAAVAFPVDDDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHC--Y 64

  Fly    70 PDSYSVRAGS---TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPL 131
            .....||.|.   ...:|..|..|...:|.||:||.:||.|||.|:||....||...:..|.|| 
Mouse    65 KTRIQVRLGEHNIKVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALP- 128

  Fly   132 PSLNILPRTLLVAGWGNPDATDSESEPRLRGTV-VKVINQRLCQRLYSHLHRPITDDMVCAA--G 193
            .|........|::|||| ..:...|||.|...: ..::.|..|:..|.   ..||.:||||.  .
Mouse   129 SSCAPAGTQCLISGWGN-TLSFGVSEPDLLQCLDAPLLPQADCEASYP---GKITGNMVCAGFLE 189

  Fly   194 AGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
            .|:|.|.||||.|:|..|...||||:.:|||....|||||::.|||.||
Mouse   190 GGKDSCQGDSGGPVVCNGELQGIVSWGYGCALADNPGVYTKVCNYVDWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 84/223 (38%)
Tryp_SPc 25..242 CDD:238113 84/222 (38%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 84/223 (38%)
Tryp_SPc 23..241 CDD:238113 86/224 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.