DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG7829

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:255 Identity:85/255 - (33%)
Similarity:128/255 - (50%) Gaps:20/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQ-Y 69
            |:||...|..:....|..|||||....|...|::.||.::|.:.|..::|.:..::|||||:. .
  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73

  Fly    70 PDS-YSVRAGSTFT-DGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLP 132
            |.. ..|:.|.|.. ...|:..:|..:.:|.:||.:|::.||.:::|.|:.||...::.:  |:.
  Fly    74 PHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAI--PIN 136

  Fly   133 SLNILPRT-LLVAGWG----NPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAA 192
            ...:...| ..:||||    |...:||     ||...|.::||..|:.|   |.:.:||.|:||.
  Fly   137 PERVAEGTYATIAGWGFKSMNGPPSDS-----LRYARVPIVNQTACRNL---LGKTVTDRMLCAG 193

  Fly   193 --GAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLENDR 250
              ..|.|.|..|||.||..|....||||:..|||....||||:||.....|:..||...:
  Fly   194 YLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLNKSK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 77/227 (34%)
Tryp_SPc 25..242 CDD:238113 76/226 (34%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 77/226 (34%)
Tryp_SPc 28..248 CDD:238113 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.