DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and intr

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:91/233 - (39%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQY------PDSYSVRAGSTFTDGGGQR 88
            |.|..:..::..|.......||.|||::..::|:..|...      |.||.::|         .|
  Fly    93 EAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRSYKLQA---------SR 148

  Fly    89 RNVVSVILHPDFNLRT--LENDIALL----KLDKSFTLGGNIQVVKLPLPSLNILPRTLLVAGWG 147
            ..:.||.     ||.|  :| |:|||    .|:..|.  ..|.:.:.||..              
  Fly   149 SRIYSVA-----NLITGAIE-DMALLLLHAPLEDPFV--HPIDLCESPLRR-------------- 191

  Fly   148 NPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRP-ITDDMVCAAGAGR-DHCYGDSGAPLVHR 210
            |.:.|...|:..||....|:|....|:|.|:..... ||..|:||..:.| ..|....|..|:|:
  Fly   192 NDNVTMYMSQQHLRFLRTKLIPNSNCKRSYAQDENAFITQTMLCALNSNRLVDCQTAKGDVLLHQ 256

  Fly   211 GSSYGIVSFAHGCADPHFPG-VYTRLANYVTWIFNVLE 247
            ....|:..:...|:|....| :|..:....|.:.:::|
  Fly   257 DRLCGVDIYGQHCSDGGVNGELYADVFKARTELMHLIE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 56/226 (25%)
Tryp_SPc 25..242 CDD:238113 56/226 (25%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 52/202 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.