DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG34129

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:245 Identity:64/245 - (26%)
Similarity:114/245 - (46%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIVGGVE--VPIHLTPWLASI-TVHGNYSCSSALITSLWLVTAGHCVQYPDSYSVRA----GSTF 81
            |:.|||:  ...:...||..| ...||::|.:|....|.::|:.:|: ||...|:..    |:.|
  Fly    39 RVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCI-YPYRNSLEGATVEGTAF 102

  Fly    82 TDGGGQRRNVVSVILHPD-FNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPR-TLLVA 144
            ::...:....:..|..|: |..:.|..|:|:::| :....|...:.::  |.|:.:.|: .::|.
  Fly   103 SECDRENYADIDTIQFPEKFIYQKLYMDVAVVRL-RDPVRGRLTEFIR--LCSVKVQPKMQMVVF 164

  Fly   145 GWG--NPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCA-AGAGRDHCYGDSGAP 206
            |||  |.:.....|:|  |...|.:|:.:.|::.:.  ...|....:|| .......|..|.|:|
  Fly   165 GWGFDNTEVEIPSSDP--RNVTVTIISIKECRQKFK--SPKIASTSICARQPKNPKQCLYDGGSP 225

  Fly   207 LVHRGSSYGIVSFAHGCADPHFPGVYT---RLANYVTWIFNVLENDRKIN 253
            |::.....|:|||...|.|...||:||   |:..::|      |.:..||
  Fly   226 LIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFIT------ETEESIN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 61/232 (26%)
Tryp_SPc 25..242 CDD:238113 60/231 (26%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 60/229 (26%)
Tryp_SPc 55..261 CDD:304450 56/213 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.