DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG7142

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:287 Identity:72/287 - (25%)
Similarity:120/287 - (41%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICGHKTSAL-SPQE-----RIVGGVEVPIHLTPWLASI--------TVHGNYSCS 51
            ||:.|..||   .::.|.| :|::     :.:...|...|..|::.||        .||   .|:
  Fly    53 MNLAAYGLL---ENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVH---YCA 111

  Fly    52 SALITSLWLVTAGHCVQYPDSYS---VRAGS-TFTDGGGQRRNVVSVILHPDFNLR-------TL 105
            ..:|...|::||.||:..|.:..   :.||| ...|..|:..|:  .:.|.|:.:|       ..
  Fly   112 GTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNI--QMRHIDYYVRHELYLGGVN 174

  Fly   106 ENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPR---TLLVAGWGNPDATDSESEP-RLRGTVVK 166
            ..||||:...:.......:|  ...||..:..|.   ||.  ||||...|...:.| ||:...:.
  Fly   175 PYDIALIYTKEPLVFDTYVQ--PATLPEQDAQPEGYGTLY--GWGNVSMTAVPNYPHRLQEANMP 235

  Fly   167 VINQRLCQRLYSHLHRPITDDMVCAA--GAGRDHCYGDSGAPLVHR---------GSSYGIVSFA 220
            :::..||:::.:....|:.:..:|..  ..|...|..|||.||:.:         ....||||:.
  Fly   236 ILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWG 300

  Fly   221 H-GCADPHFPGVYTRLANYVTWIFNVL 246
            . .|...:.|.|:.|::.:..||..|:
  Fly   301 KMPCGQKNAPSVFVRVSAFTEWINQVI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 61/252 (24%)
Tryp_SPc 25..242 CDD:238113 61/251 (24%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 63/250 (25%)
Tryp_SPc 84..323 CDD:214473 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.