DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG3916

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:277 Identity:71/277 - (25%)
Similarity:128/277 - (46%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLL---ICGHKTSALSPQERIVGGVEVPIHLTPWLASITV--HGNYS--CSSALITSL 58
            :.:..::|:|   :....||......||.||..|. ...|:..|:.:  .|.:.  |..::::..
  Fly     4 LQLFCMLLILRQGLADVVTSTTESPTRINGGQRVN-ETVPFQVSLQMQRRGRWQHFCGGSIVSGQ 67

  Fly    59 WLVTAGHCVQ--YPDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLR-TLENDIALLKLDKSFTL 120
            .::||.||::  ..:..||..|:.....||.|..:|:..:||.:::. .:.|||||:|:...|.|
  Fly    68 HVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRHRLVTKHVHPQYSMNPRIINDIALVKVTPPFRL 132

  Fly   121 ----------GGNIQV-VKLPLPSLNILPRTLLVAGWG--NPDATDSESEPRLRGTVVKVINQRL 172
                      ||:.:: .|:|          :.:.|||  :|..:.:....:|:....:.|:...
  Fly   133 ERSDISTILIGGSDRIGEKVP----------VRLTGWGSTSPSTSSATLPDQLQALNYRTISNED 187

  Fly   173 C-QRLYSHLHRPITDDMVCA-AGAGRDHCYGDSGAPLVHRGSS---YGIVSFAHGCADPHFPGVY 232
            | |:.:.     :|.:.:|| |..|:..|.||||.||:..|..   .||||:.........|.||
  Fly   188 CNQKGFR-----VTRNEICALAVQGQGACVGDSGGPLIRPGKQPHLVGIVSYGSSTCAQGRPDVY 247

  Fly   233 TRLANYVTWIFNVLEND 249
            ||:::::.:|..|:..|
  Fly   248 TRVSSFLPYISQVINQD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 64/242 (26%)
Tryp_SPc 25..242 CDD:238113 63/241 (26%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 64/242 (26%)
Tryp_SPc 31..260 CDD:238113 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D526726at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.