DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG17404

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:278 Identity:77/278 - (27%)
Similarity:109/278 - (39%) Gaps:84/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SALSPQERIVGGVEVP--IHLTPWLASI---TVHGN-YSCSSALITSLWLVTAGHCVQ--YPDSY 73
            |..:| .|||||.::|  .|: |:..|:   |..|. :.|..::|....::||.||.|  .....
  Fly    28 SGYTP-HRIVGGADIPPGEHV-PYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRM 90

  Fly    74 SVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKL-------------------DKSFT 119
            ||.||....:..|.|..|:|..:||.:. ..:.:|:|:|.:                   .|.| 
  Fly    91 SVVAGIRGLNEKGSRSQVLSYSIHPKYQ-ELVTSDLAVLSIKPPLKLNNSTISAIEYRSQGKDF- 153

  Fly   120 LGGNIQV------VKLPLP--------SLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQ 170
            :||.:.|      ::||:|        ..|:|.|...        .|.|.||.|..|.       
  Fly   154 VGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSY--------HTISNSECRNAGM------- 203

  Fly   171 RLCQRLYSHLHRPITDDMVCAAGAGRDHCYGDSGAPLVHRGS---------SYGIVSFAHGCADP 226
                       ..:||..:||.|..|..|.||||.|||....         |||:|.    |...
  Fly   204 -----------ESVTDTEICARGPFRGACSGDSGGPLVMESKNGLQQVGIVSYGLVV----CGLY 253

  Fly   227 HFPGVYTRLANYVTWIFN 244
            ..|.||||::.:..||.|
  Fly   254 ISPDVYTRVSTFSDWIGN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 72/267 (27%)
Tryp_SPc 25..242 CDD:238113 71/266 (27%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 72/267 (27%)
Tryp_SPc 35..269 CDD:238113 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D526726at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.