DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG16749

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:262 Identity:82/262 - (31%)
Similarity:128/262 - (48%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALILLLICGHKTSALS---PQ-ERIVGGVEVPIHLTPWLASIT-VHGNYSCSSALITSLWLVTA 63
            ||:..||    .|:.:|   || .|:|.|.:..:...|::.|:. ..|::||..::|:..:::||
  Fly     9 LAVFALL----TTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTA 69

  Fly    64 GHCV--QYPDSYSVRAGSTFTDGGGQRRNVV---SVILHPDFN-LRTLENDIALLKLDKSFTLGG 122
            .||.  :.....||:.|.|..:..|.  |||   .:|.|.|:| .....|||:||.:::.|...|
  Fly    70 AHCTDGRKASDLSVQYGVTKINATGP--NVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDG 132

  Fly   123 NIQVVKLPLPSLNI-LPRT------LLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHL 180
             :.|..:.||.|.. .|:|      :|: ||| .:||....:..|:...:||.:...|    :..
  Fly   133 -VTVAPVKLPELAFATPQTDAGGEGVLI-GWG-LNATGGYIQSTLQEVELKVYSDEEC----TER 190

  Fly   181 HRPITDDMVCAAG----AGRDHCYGDSGAPLVHRGSSYGIVSFA-HGCADPHFPGVYTRLANYVT 240
            |...||......|    .|:..|.||||.||::.|...||||:: ..|....:||||.:::.||.
  Fly   191 HGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVD 255

  Fly   241 WI 242
            ||
  Fly   256 WI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 72/236 (31%)
Tryp_SPc 25..242 CDD:238113 71/235 (30%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/236 (31%)
Tryp_SPc 30..259 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.