DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Prss57

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_038935644.1 Gene:Prss57 / 408241 RGDID:1303330 Length:290 Species:Rattus norvegicus


Alignment Length:266 Identity:81/266 - (30%)
Similarity:129/266 - (48%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALILLLICGHKTSALSPQE-----RIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTA 63
            |..:|.|...:.|..|.|.:     .||||.||..|..|::||:...|::.|...|..:.|:::|
  Rat    20 LTQLLWLPGENSTWPLDPTQGCCGSHIVGGHEVKPHARPYMASVNFEGHHHCGGFLFHAHWVLSA 84

  Fly    64 GHCVQYPDSYSVRAGST-----------FTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKS 117
            .||      :|.|..||           ..:...|...:.:|:.||||...|..|||.||:|:.|
  Rat    85 AHC------FSDRDPSTGLVVLGAHALLTPEPTQQVFGIAAVVSHPDFEPTTQANDICLLRLNGS 143

  Fly   118 FTLGGNIQVVKLPLPSLN--ILPRTLLVAGWGNPDATD-SESEPRLRGTVVKVINQRLCQRLYSH 179
            ..||..:::::||.....  :......|:|||:  .:| .|..|.|....|::::..:|.   |.
  Rat   144 AVLGPAVRLLRLPRRGAKPPVAGTRCRVSGWGS--VSDFEEPPPGLMEVEVRILDLSVCN---SS 203

  Fly   180 LHRPITDDMVCAAGAG---RDHCYGDSGAPLVHRGSSYGIVSFAH-GCADPHFPGVYTRLANYVT 240
            ....::..|:|.....   |..|..|||.|||....::|:|||:. .|.||..|.|||:::.:|:
  Rat   204 WQGQLSPAMLCTHSGDRRRRGFCSADSGGPLVCGNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVS 268

  Fly   241 WIFNVL 246
            ||::|:
  Rat   269 WIWDVV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 72/235 (31%)
Tryp_SPc 25..242 CDD:238113 72/234 (31%)
Prss57XP_038935644.1 Tryp_SPc 46..270 CDD:238113 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D526726at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.